4.67 Rating by ClearWebStats
It has a .lk as an domain extension. This domain is estimated value of $ 8.95 and has a daily earning of $ 0.15. While no active threats were reported recently by users, kgntravels.lk is SAFE to browse.
Get Custom Widget

Traffic Report of Kgntravels

Daily Unique Visitors: Not Applicable
Daily Pageviews: Not Applicable

Estimated Valuation

Income Per Day: $ 0.15
Estimated Worth: $ 8.95

Search Engine Indexes

Google Indexed Pages: Not Applicable
Yahoo Indexed Pages: Not Applicable
Bing Indexed Pages: Not Applicable

Search Engine Backlinks

Google Backlinks: Not Applicable
Bing Backlinks: Not Applicable
Alexa BackLinks: Not Applicable

Safety Information

Google Safe Browsing: No Risk Issues
Siteadvisor Rating: No Risk Issues
WOT Trustworthiness: Not Applicable
WOT Privacy: Not Applicable
WOT Child Safety: Not Applicable

Website Ranks & Scores

Google Pagerank: Not Applicable
Alexa Rank: Not Applicable
Domain Authority: 8 ON 100 Click to see kgntravels.lk data on Moz
Google Pagerank
PR 0 out of 10
PageSpeed Score
0
Siteadvisor Rating
View kgntravels.lk site advisor rating No Risk Issues

Where is kgntravels.lk server located?

Hosted IP Address:

143.95.225.99 View other site hosted with kgntravels.lk

Hosted Country:

kgntravels.lk hosted country US kgntravels.lk hosted country

Location Latitude:

34.0549

Location Longitude:

-118.2578

Social Engagement

Facebook Shares: Not Applicable
Facebook Likes: Not Applicable
Facebook Comments: Not Applicable
Twitter Count (Tweets): Not Applicable
Linkedin Shares: Not Applicable
Delicious Shares: Not Applicable

Page Resources Breakdown

View kgntravels.lk HTML resources

Homepage Links Analysis

KGN Travels - Coming Soon

Website Inpage Analysis

H1 Headings: Not Applicable H2 Headings: 1
H3 Headings: Not Applicable H4 Headings: 1
H5 Headings: Not Applicable H6 Headings: Not Applicable
Total IFRAMEs: Not Applicable Total Images: 1
Google Adsense: Not Applicable Google Analytics: Not Applicable

Websites Hosted on Same IP (i.e. 143.95.225.99)

Antalya Adaklık Kurbanlık - 7/24 İletişim İçin 0553 402 0740

kgntravels.lk favicon - antalya-adaklikkurbanlik.com

View kgntravels.lk Pagerank   kgntravels.lk alexa rank Not Applicable   kgntravels.lk website value $ 8.95

Antalya En Yakın Lastikçi - 7/24 Mobil Lastikçi 0 542 611 69 87 Arayın

kgntravels.lk favicon - antalyaenyakinlastikci.com

View kgntravels.lk Pagerank   kgntravels.lk alexa rank Not Applicable   kgntravels.lk website value $ 8.95

Abdullah Saeed – All the latest article

kgntravels.lk favicon - abdullahblog.com

View kgntravels.lk Pagerank   kgntravels.lk alexa rank Not Applicable   kgntravels.lk website value $ 8.95

Index of /

kgntravels.lk favicon - spredtechnologies.com

View kgntravels.lk Pagerank   kgntravels.lk alexa rank Not Applicable   kgntravels.lk website value $ 8.95

Antalya Sepetli Vinç Kiralama - İletişim İçin : 0543 875 3833

kgntravels.lk favicon - antalyaenessepetlivinckiralama.com

View kgntravels.lk Pagerank   kgntravels.lk alexa rank Not Applicable   kgntravels.lk website value $ 8.95

HTTP Header Analysis

HTTP/1.1 200 OK
Server: nginx/1.18.0
Date: Sun, 10 Oct 2021 21:15:19 GMT
Content-Type: text/html
Transfer-Encoding: chunked
Connection: keep-alive
Last-Modified: Sun, 10 Oct 2021 15:19:49 GMT
Content-Encoding: gzip

DNS Record Analysis

Host Type TTL Extra
kgntravels.lk A 14396 IP:143.95.225.99
kgntravels.lk NS 86400 Target:ns1.webserversystems.com
kgntravels.lk NS 86400 Target:ns2.webserversystems.com
kgntravels.lk SOA 86400 MNAME:ns1.webserversystems.com
RNAME:procurement.mack5ive.com
Serial:2021090802
Refresh:86400
Retry:7200
Expire:3600000
kgntravels.lk MX 14400 Target:mail.kgntravels.lk
kgntravels.lk TXT 14400 TXT:v=spf1 a mx include:websitewelcome.com
~all

Similarly Ranked Websites to Kgntravels

Google

kgntravels.lk favicon - google.com

Search the world's information, including webpages, images, videos and more. Google has many special features to help you find exactly what you're looking for.

View kgntravels.lk Pagerank   Alexa rank for kgntravels.lk 1   website value of kgntravels.lk $ 8,833,062,960.00

Google Calendar - Sign in to Access & Edit Your Schedule

kgntravels.lk favicon - calendar.google.com

Access Google Calendar with a Google account (for personal use) or Google Workspace account (for business use).

View kgntravels.lk Pagerank   Alexa rank for kgntravels.lk 1   website value of kgntravels.lk $ 8,833,062,960.00

Gmail

kgntravels.lk favicon - mail.google.com

Gmail is email that’s intuitive, efficient, and useful. 15 GB of storage, less spam, and mobile access.

View kgntravels.lk Pagerank   Alexa rank for kgntravels.lk 1   website value of kgntravels.lk $ 8,833,062,960.00

Android Apps on Google Play

kgntravels.lk favicon - play.google.com

Enjoy millions of the latest Android apps, games, music, movies, TV, books, magazines & more. Anytime, anywhere, across your devices.

View kgntravels.lk Pagerank   Alexa rank for kgntravels.lk 1   website value of kgntravels.lk $ 8,833,062,960.00

Google Chrome - Download the Fast, Secure Browser from Google

kgntravels.lk favicon - chrome.google.com

Get more done with the new Google Chrome. A more simple, secure, and faster web browser than ever, with Google’s smarts built-in. Download now.

View kgntravels.lk Pagerank   Alexa rank for kgntravels.lk 1   website value of kgntravels.lk $ 8,833,062,960.00